-
Notifications
You must be signed in to change notification settings - Fork 40
New issue
Have a question about this project? Sign up for a free GitHub account to open an issue and contact its maintainers and the community.
By clicking “Sign up for GitHub”, you agree to our terms of service and privacy statement. We’ll occasionally send you account related emails.
Already on GitHub? Sign in to your account
protein sequence output file #123
Comments
Sorry I could not get your point. Could you rephrase ur question? |
hi,
1. I want to get a protein sequence of the CAZyme when I run the dbCAN.
How do I get the output file that looks like this? (has the following info)
NC_000913.3_1054 3.2.1.-:GH73(160-295):GH73_e114:GH73:N:3
MISDSKLLASAAWDAQSLNELKAKAGEDPAANIRPVARQVEGMFVQMMLKSMRDALPKDG
LFSSEHTRLYTSMYDQQIAQQMTAGKGLGLAEMMVKQMTPEQPLPEESTPAAPMKFPLET
VVRYQNQALSQLVQKAVPRNYDDSLPGDSKAFLAQLSLPAQLASQQSGVPHHLILAQAAL
ESGWGQRQIRRENGEPSYNLFGVKASGNWKGPVTEITTTEYENGEAKKVKAKFRVYSSYL
EALSDYVGLLTRNPRYAAVTTAASAEQGAQALQDAGYATDPHYARKLTNMIQQMKSISDK
VSKTYSMNIDNLF*
2.Can I run dbCAN on both FAA and FNA files? or is it just FNA files?
Grace
…On Thu, Jul 27, 2023 at 4:35 PM Le Huang ***@***.***> wrote:
Sorry I could not get your point. Could you rephrase ur question?
—
Reply to this email directly, view it on GitHub
<#123 (comment)>,
or unsubscribe
<https://github.com/notifications/unsubscribe-auth/BBRYYJ6RDJPVZERJFEN2AGDXSLGJ7ANCNFSM6AAAAAA22LYRKI>
.
You are receiving this because you authored the thread.Message ID:
***@***.***>
|
This file located in the temporary folder
|
Sign up for free
to join this conversation on GitHub.
Already have an account?
Sign in to comment
I'm running the dbcan on faa files on linux to predict the CAZymes and saw that I can get a protein sequence of the gene (this link shows an output of the gene with the protein sequence: https://bcb.unl.edu/dbCAN2/data/blast/20221121163906/CAZyme.pep) . How do I get that ^^output file?
The text was updated successfully, but these errors were encountered: